DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Prss45

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:240 Identity:55/240 - (22%)
Similarity:92/240 - (38%) Gaps:67/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWI-----AWEFRGKQVAGLLRHPKF-SPLT 104
            :..|:|....:|::.|||.:.|   :|.||..|...:     :|..: ..|..::.|||: ....
Mouse    74 VCGGALIDRSWVVSAAHCIQGN---KEYSVMLGSSTLHPNGSSWTLK-IPVGDIIIHPKYWGRNF 134

  Fly   105 LRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQE-----------LAGWNLMHIAQPL 158
            :|:|||:|.::..::.:..:..|.|             |:.           :.||     .|..
Mouse   135 IRSDIALLCLETPVTFNKYVQPICL-------------PEHNFNFKVGTKCWVTGW-----GQVK 181

  Fly   159 KSMSVQVEP-------------EKNCRQWF----------PQISGGVICASATMGEGLCYGDSGD 200
            :..|.|:.|             .|||...|          |.|...:|| :...||.|||||.|.
Mouse   182 QHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMIC-TTNYGEDLCYGDPGG 245

  Fly   201 PL---ISGGEVCGLAIAFRK-CGDKRYPALFTDVHYHRAFIAQAV 241
            ||   |.|..:.....::.| |......:::|.:..:..:|...|
Mouse   246 PLACEIDGRWILAGVFSWEKACATVPNLSVYTRITKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/236 (23%)
Tryp_SPc 38..237 CDD:214473 53/234 (23%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 54/237 (23%)
Tryp_SPc 59..286 CDD:214473 53/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.