DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG30288

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:234 Identity:54/234 - (23%)
Similarity:89/234 - (38%) Gaps:64/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKF-------SPL 103
            :..|||.:||:|||..||.    .|..::||.|      |:.       .|||.|       :|.
  Fly    67 VCGGSLITARFVLTAEHCI----SPMYMNVRLG------EYD-------TRHPIFDCDDFVCTPR 114

  Fly   104 TLR-------------NDIAVLRVKAAISHSHMINYIGLC------SRPLTPLNMFAPPQELAGW 149
            ...             .||.:||::.::..|:.:..|.|.      ..||:.|..     ...||
  Fly   115 AYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRF-----NFTGW 174

  Fly   150 NLMHIAQP---LKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGDPLIS------G 205
            ......:.   |::.::|..|:.:|.:....:....|||.:.:.:. |.||||.||.:      .
  Fly   175 GTNSDGEEQDRLQTATLQQLPQWSCERPGRPLDISYICAGSYISDS-CKGDSGGPLSAIRTFEGQ 238

  Fly   206 GEVCGLAIA---FRKCGDKRYPALFTDVHYHRAFIAQAV 241
            |.|....:|   .|.|...   .::|:|.:...:|...:
  Fly   239 GRVFQFGVASQGLRLCSGL---GIYTNVTHFTDWILDVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/230 (23%)
Tryp_SPc 38..237 CDD:214473 53/228 (23%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 53/228 (23%)
Tryp_SPc 45..270 CDD:238113 53/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472870
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.