DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG30287

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:275 Identity:74/275 - (26%)
Similarity:102/275 - (37%) Gaps:72/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLQLILL------------------AIAVRWGDALHR---GIPVQQ-QNYGYVMQIYGPQFLAAG 49
            ::||:||                  .:..|....|:|   |.|... .|...|:.|........|
  Fly     5 AVQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGG 69

  Fly    50 SLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVA-----GLLRHPKFSPLT----- 104
            ||.:.|||||.||| |..|| .:|:||.|      ::...|..     |.:..|:...:|     
  Fly    70 SLITPRYVLTAAHC-KSETK-SQLTVRLG------DYDVNQAVDCSSYGCIPRPREINVTRTYVP 126

  Fly   105 ------LRNDIAVLRVKAAISHSHMINYIGL-------CSRPLTPLNMFAPPQELAGWNL--MHI 154
                  .:||||:||::..:.:...|..|.|       .|..|..|..|    ...||..  ..|
  Fly   127 SHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKF----NTTGWGRTESRI 187

  Fly   155 AQP-LKSMSVQVEPEKNCRQWF-PQISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRK 217
            ..| |:..|:.......|.|.| .|:....||.:::.| ..|.||||.||          .|..:
  Fly   188 NSPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG-STCQGDSGGPL----------TARVR 241

  Fly   218 CGDKRYPALFTDVHY 232
            .|.:|...||..|.|
  Fly   242 IGSERRVILFGVVSY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 63/222 (28%)
Tryp_SPc 38..237 CDD:214473 63/222 (28%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/239 (28%)
Tryp_SPc 42..280 CDD:238113 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.