DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG30286

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:250 Identity:60/250 - (24%)
Similarity:93/250 - (37%) Gaps:82/250 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGK-----------------QV 91
            :.:..|:|.:.|::||.|||.:::   |.|:||.|      ||...                 ::
  Fly    57 ELVCGGTLVNHRFILTAAHCIRED---ENLTVRLG------EFNSLTSIDCNGSDCLPPSEDFEI 112

  Fly    92 AGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRP-----------LTPLNMFAPPQE 145
            ....||..:|.....:||.:||:..::.:...|..|.|.:..           |........|.|
  Fly   113 DVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSE 177

  Fly   146 LAGWNLMHIAQPLKSMSVQVEPEKNCRQWFPQISGGV-------------ICASATMGEGLCYGD 197
            .|.    ||   |||:.|            .:::.||             ||.|...|.. |.||
  Fly   178 AAN----HI---LKSIRV------------TRVNWGVCSKTYWVDRRRDQICVSHESGVS-CSGD 222

  Fly   198 SGDPLISGGEVCGL--AIAFRKCGDKRY-------PALFTDVHYHRAFIAQAVLT 243
            ||.|:   |:...|  .:.|.:.|...|       |::||:|..|..:|..|:.|
  Fly   223 SGGPM---GQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWIMAALST 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 58/244 (24%)
Tryp_SPc 38..237 CDD:214473 57/242 (24%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 57/243 (23%)
Tryp_SPc 39..268 CDD:214473 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.