DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG30187

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:269 Identity:55/269 - (20%)
Similarity:93/269 - (34%) Gaps:101/269 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QNYGYVMQIYG-PQFLAAGSLFSARYVLTVAHC-------------FKKNTKPE----------- 71
            ||..::..::. ..|:..|:|...|:|||.|||             :.|:...:           
  Fly    45 QNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDPADRKDVITAVVHS 109

  Fly    72 ELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDI---AVLRVKAAISHSHMINYIGLCSRP 133
            ...|||.|         :...|||:        |.:|:   |::|....:.:..|.|::    |.
  Fly   110 SFDVRASY---------ENDIGLLK--------LSSDVIFNALIRPICIVLNKSMANHM----RN 153

  Fly   134 LTPLNMFAPPQELAGWN---------------LMHIAQPLKSMSVQVEP-EKNCRQWFPQISGGV 182
            :.....|       ||.               |.|:.:....|.:.|.| ||.            
  Fly   154 MRTFKAF-------GWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQ------------ 199

  Fly   183 ICASATMGEGLCYGDSGDPLISGGEVCG----------LAIAFRKCGDKRYPALFTDVHYHRAFI 237
            |||....|: .|.||||.||.:...:.|          :::....|..:   .::||:   .:|.
  Fly   200 ICAGVPSGD-TCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQ---GVYTDL---MSFA 257

  Fly   238 AQAVLTLDR 246
            ....:|::|
  Fly   258 DWIKMTIER 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/254 (20%)
Tryp_SPc 38..237 CDD:214473 50/252 (20%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 53/261 (20%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.