DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG30090

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:238 Identity:64/238 - (26%)
Similarity:94/238 - (39%) Gaps:62/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAG-YRWIAWEFRGKQVA----------GLLRH 97
            :.:..|:|.:.|:|||.|||..:.:   .:.||.| |...|.|....::.          ...||
  Fly    62 KLICGGTLITQRFVLTAAHCVNEGS---AVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRH 123

  Fly    98 PKFSPLTLRNDIAVLRV------KAAISHSHMINYIGLCSRPLT-PLNMFAPPQELAGW------ 149
            .|||.:...||||:||:      ||.||...:|  :|...|.|. .:..|.    ..||      
  Fly   124 GKFSEIKNLNDIALLRLAKFVTFKAHISPICII--LGTSKRELVDSIEWFV----ATGWGETRTH 182

  Fly   150 ---NLMHIAQPLKSMSVQVEPEKNCRQWFPQ-ISGGVICASATMGEGLCYGDSGDPL-------- 202
               .::.|.|..:..|.|      |.|...: :....||| ..:|...|.||||.||        
  Fly   183 RTRGVLQITQLQRYNSSQ------CMQALGRLVQQNQICA-GRLGSDTCNGDSGGPLFQTVRHMD 240

  Fly   203 ----ISGGEVCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAV 241
                :..|.|   :...|:|..   ..::|||:.:..:||..|
  Fly   241 KMRPVQFGVV---SYGSRECSG---IGVYTDVYSYADWIATVV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 62/234 (26%)
Tryp_SPc 38..237 CDD:214473 61/232 (26%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 61/232 (26%)
Tryp_SPc 40..276 CDD:238113 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.