DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Habp2

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 / 226243 MGIID:1196378 Length:554 Species:Mus musculus


Alignment Length:250 Identity:65/250 - (26%)
Similarity:98/250 - (39%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WGDALHRGIPVQQQNYGYVMQIYGPQ-FLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWI 82
            |..:|...:|:....         || ....|:|....:|||.|||...|||  .|.|..|.:.:
Mouse   321 WQVSLQTSLPLTTSM---------PQGHFCGGALIHPCWVLTAAHCTDINTK--HLKVVLGDQDL 374

  Fly    83 AWEFRGKQVAGLLRHPKFSPLTLR-----NDIAVLRVKAAISHSHM-INYIGLCSRPLTPLNMFA 141
            ......:|...:.:..|:|....|     ||||:|::|....|..: ..|:.....|..|   |.
Mouse   375 KKTESHEQTFRVEKILKYSQYNERDEIPHNDIALLKLKPVGGHCALESRYVKTVCLPSDP---FP 436

  Fly   142 PPQE--LAGWNLMHIAQPLKSM-----SVQVEPEKNCRQWFPQ-ISGGVICASATM--GEGLCYG 196
            ...|  ::||.:....:..:.:     .:...|..|.||.:.. |...:|||....  |...|.|
Mouse   437 SGTECHISGWGVTETGEGSRQLLDAKVKLIANPLCNSRQLYDHTIDDSMICAGNLQKPGSDTCQG 501

  Fly   197 DSGDPLISGGE----VCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAVLTLDRE 247
            |||.||....:    |.|:....::||.|  |.::|.|   ..|:.....|:.||
Mouse   502 DSGGPLTCEKDGTYYVYGIVSWGQECGKK--PGVYTQV---TKFLNWIKTTMHRE 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 59/221 (27%)
Tryp_SPc 38..237 CDD:214473 58/219 (26%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011
KR 187..271 CDD:238056
Tryp_SPc 308..547 CDD:238113 62/244 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.