DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and T22A3.6

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:86 Identity:19/86 - (22%)
Similarity:34/86 - (39%) Gaps:16/86 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TVAHCFKKNTKPEELSV------RAGYRWIAWEFRG----KQVAG------LLRHPKFSPLTLRN 107
            |.|.||:......|.|.      |.|:.:..::...    .|:.|      |:...:|...:|.:
 Worm   164 TTAPCFQPCRPSTETSSDFVCLNRDGFPYTDYDMSDILDLPQLIGIFKDVDLMYESRFVLPSLPD 228

  Fly   108 DIAVLRVKAAISHSHMINYIG 128
            .:..|..|:.|:..|:.|:.|
 Worm   229 GVQRLSTKSCINKGHIANHFG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 19/86 (22%)
Tryp_SPc 38..237 CDD:214473 19/86 (22%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.