DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and try-5

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:263 Identity:59/263 - (22%)
Similarity:97/263 - (36%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QFLAAGSLFSARYVLTVAHCFKKN-----TKPEELSVRAGY-----RWIAWEF------------ 86
            :.:..|:|.:.::|||.||||:|:     ...||.|:...|     |:...|.            
 Worm    70 EVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMC 134

  Fly    87 -RGKQVAGLLRHPKFSPLTLR-----------------NDIAVLRVKAAISHSHMINYIGLCSRP 133
             |.:|..|.: :.|.:..||:                 |||.:|.:::.|......||..|   |
 Worm   135 TRLEQKYGCV-NEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACL---P 195

  Fly   134 LTP-LNMFAPPQELA-GW------NLMHIAQP-LKSMSVQVEPEKNCRQ-WFPQISGGVICASAT 188
            ..| :|:.:.....: ||      ...:.|.| ::.:::..|....|.: |...|.....|.:..
 Worm   196 FLPEVNIQSGANVTSFGWGSDPGKGFDNAAFPMIQVLTLATETLATCEENWGTSIPFDSFCTAEE 260

  Fly   189 MGEGLCYGDSGDPL---------------ISGGEVCGLAIAFRKCGDKRYPALFTDVHYHRAFIA 238
            ..:.:|.||||..|               :|.|..|...|.    |.:....:.|||..|:.||.
 Worm   261 EDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGSDCVQLIG----GSEPRSQINTDVRKHQKFIV 321

  Fly   239 QAV 241
            ..:
 Worm   322 NFI 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 59/259 (23%)
Tryp_SPc 38..237 CDD:214473 57/257 (22%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 50/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.