DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and try-4

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:301 Identity:66/301 - (21%)
Similarity:108/301 - (35%) Gaps:112/301 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VESLQLILLAIAVRWGDALHRGIPVQQQ----NYGYVMQ--IYGPQFLAAGSLFSARYVLTVAH- 62
            :||.|.|:      ..:.|.....:||:    |:.:.:.  :.|...| .||:.|..:::|.|| 
 Worm    31 MESFQTIV------DNEVLMESCGIQQESKIKNFPWAVSFTVDGVNRL-GGSIISPYHIITAAHG 88

  Fly    63 -----------CFKKNTKPEELSVRAGYRWIAW-------EFRGKQVAGLL-RHPKFSPLTLRND 108
                       |..||.|....|:   ||.|.:       .:.|..:.|.. ::|. .|...::|
 Worm    89 FITTIGSRGNLCENKNWKKPNSSI---YRSIKFLRDTRKVAYGGTCIRGHTDKYPN-DPRCKKSD 149

  Fly   109 I-------------------------AVLRVKAAISHSHMINYIGLCSRPLTPLNMF-----APP 143
            :                         |::.|:..|..|..:..|.| .||    ||:     |.|
 Worm   150 VIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICL-PRP----NMYYTKSLAVP 209

  Fly   144 QELAGWNLMHI---AQPLKSMSVQVEPEKNC-RQW---FPQISGGVICASAT-----MGEGLCYG 196
                ||...:|   :.|| ...:.:..:::| |.|   .|..:...|||::.     .....|:|
 Worm   210 ----GWGRSYIFNESGPL-IHEIPMRIDRDCKRPWSDRLPADADDFICATSMNVSNYSAPRTCHG 269

  Fly   197 DSGDPLISGGEVCGLAIAFRKCGDKRYPALFTDVHYHRAFI 237
            |||     ||      :.:|            |.:|.|||:
 Worm   270 DSG-----GG------LEYR------------DDNYGRAFL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 58/264 (22%)
Tryp_SPc 38..237 CDD:214473 57/262 (22%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 60/275 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.