DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Hgf

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001276387.1 Gene:Hgf / 15234 MGIID:96079 Length:728 Species:Mus musculus


Alignment Length:251 Identity:61/251 - (24%)
Similarity:102/251 - (40%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNYGYVMQI-YGPQFLAAGSLFSARYVLTVAHCF---KKNTKPEELSVRAGYRWIAW-- 84
            |||. |...|:::.: |..:.:..|||....:|||...||   .|:.|..|          ||  
Mouse   499 GIPT-QTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYE----------AWLG 552

  Fly    85 --------EFRGKQ---VAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGL----CSRP- 133
                    |.:.||   ::.|:..|:.|      |:.:|::.......:.::.|.|    |:.| 
Mouse   553 IHDVHERGEEKRKQILNISQLVYGPEGS------DLVLLKLARPAILDNFVSTIDLPSYGCTIPE 611

  Fly   134 LTPLNMFAPPQELAGW---NLMHIAQPLKSMSVQVEPEKNCRQWFP---QISGGVICASA-TMGE 191
            .|..:::       ||   .|::....|:...:.:...:.|.|...   .::...:||.| .:|.
Mouse   612 KTTCSIY-------GWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGS 669

  Fly   192 GLCYGDSGDPLISGGE----VCGLAIAFRKCGDKRYPALFTDVHYHRAFIAQAVLT 243
            |.|.||.|.|||....    |.|:.:..|.|.....|.:|..|.|:..:|.:.:||
Mouse   670 GPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILT 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 54/233 (23%)
Tryp_SPc 38..237 CDD:214473 53/231 (23%)
HgfNP_001276387.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473 58/243 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.