DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Gzmk

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:220 Identity:54/220 - (24%)
Similarity:97/220 - (44%) Gaps:22/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNYGYVMQI-YGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGK 89
            |..||..:..::..| |..:.:..|.|...::|||.|||:....:....:|..|...::.....|
Mouse    29 GREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMK 93

  Fly    90 QVAGLLRHPKFSPL---TLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMF--APPQELAGW 149
            |...:.:...||.|   :..:||.:::::.|...:..:..:.|.|:     |..  ....::.||
Mouse    94 QTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLHLGSK-----NYLRDGTKCQVTGW 153

  Fly   150 -----NLMHIAQPLKSMSVQVEPEKNC--RQWF---PQISGGVICASATMGE-GLCYGDSGDPLI 203
                 :|:..:..|:.::|.:...|.|  :.::   |.|:..:|||....|: ..|.||||.|||
Mouse   154 GTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLI 218

  Fly   204 SGGEVCGLAIAFRKCGDKRYPALFT 228
            ..|....|.....|||..:.|.::|
Mouse   219 CKGIFHALVSQGYKCGIAKKPGIYT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/208 (25%)
Tryp_SPc 38..237 CDD:214473 51/208 (25%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 54/220 (25%)
Tryp_SPc 26..256 CDD:238113 54/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.