DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Gzma

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:219 Identity:56/219 - (25%)
Similarity:94/219 - (42%) Gaps:56/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LAAGSLFSARYVLTVAHC------------FKKNTKPEE--LSVRAGYRWIAWEFRGKQVAGLLR 96
            :.||:|....:|||.|||            ...|.:||:  |:|:..:                .
Mouse    53 ICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAF----------------P 101

  Fly    97 HPKFSPLTLRNDIAVLRV--KAAISHSHMINYI---GLCSRPLTPLNMFAPPQELAGW----NLM 152
            :|.:...|...|:.::|:  ||.::.:..|.::   |...:|.|..       .:|||    |..
Mouse   102 YPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRC-------RVAGWGRFGNKS 159

  Fly   153 HIAQPLKSMSVQVEPEKNCR-----QWFPQISGGVICASATM-GEGLCYGDSGDPLISGGEVCGL 211
            ..::.|:.:::.|...|.|.     .:.|.|...:|||.... |:..|.||||.||:..|.:.|:
Mouse   160 APSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGI 224

  Fly   212 -AIAFRKCGDKRYPALFT---DVH 231
             :....||||:|:|.::|   |.|
Mouse   225 TSFGGEKCGDRRWPGVYTFLSDKH 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 56/219 (26%)
Tryp_SPc 38..237 CDD:214473 56/219 (26%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 56/219 (26%)
Tryp_SPc 29..255 CDD:238113 56/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.