DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG43742

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:260 Identity:69/260 - (26%)
Similarity:106/260 - (40%) Gaps:63/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 HRGIPVQQQNYGYVMQIY-GPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFR 87
            |..|..|     ::..:| ..:|...|||...:||||.|||.:   ..:|::|..|.     ..|
  Fly    39 HTAITSQ-----FMAALYNNSEFFCGGSLIHKQYVLTAAHCVR---DLDEVTVHLGE-----NNR 90

  Fly    88 G------KQV----AGLLRHPKFSPLTLRNDIAVLRV-KAAISHSHMINYIGLCSRPLTPL---- 137
            .      |.|    |.::.||.|......||||:||: :..|..:|:        ||:..:    
  Fly    91 SCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHI--------RPICIILDED 147

  Fly   138 ------NMFAPPQELAGWNLM---HIAQPLKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGL 193
                  |.|.    ..||...   :|:..|..:.:...|:..|.|     :...|||.:|.|: .
  Fly   148 VTSNNQNNFT----AYGWGKTEHGNISDVLSFIDLVRLPKSMCYQ-----NINTICAGSTSGD-T 202

  Fly   194 CYGDSGDPLISG----GEVCGLAIAFRKCGDKRYPALF---TDVHYHRAFIAQAVLTLDREMLSK 251
            |..|||.|||..    |:...:.......||.....||   |||:.::::||..||..:..:|::
  Fly   203 CESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIASVVLESEPRLLNE 267

  Fly   252  251
              Fly   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 62/232 (27%)
Tryp_SPc 38..237 CDD:214473 61/230 (27%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 64/244 (26%)
Tryp_SPc 35..256 CDD:238113 66/247 (27%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.