DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG43335

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:112/270 - (41%) Gaps:69/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRWGDALHR-----GIPVQQQNYGYVMQIYGP-QFLAAGSLFSARYVLTVAHCFKKNTKPEELSV 75
            :|...:.||     |...:..::.::..:|.. .:..||:|.:.::|||.|||.:.:   :.|:|
  Fly    31 IRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHCIEAS---KNLTV 92

  Fly    76 RAGYRWI-----------AWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGL 129
            |.|...:           |.::   .|:..::|..|:|..:.||||::|:...:.....|..|.:
  Fly    93 RLGGSGLTRSDGSMCQITAEDY---SVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICI 154

  Fly   130 CSRPLTPLNMFAPPQELA-GWNLM------HIAQ--PLKSMSVQVEPEKNCRQWFP-QISGGVIC 184
            ...|...|.:......:| ||.|.      |:.|  |:..|:..|     |.:.:. .|:.|.||
  Fly   155 ILDPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNV-----CSKLYDVAITQGQIC 214

  Fly   185 ASATMGE---GLCYGDSGDPLISGGEVCGLAIAFRKCGDKRY---------------PALFTDVH 231
            |    |:   ..|.||||.||  ||.|       ...||.|:               |:::||:.
  Fly   215 A----GDKETNTCLGDSGGPL--GGVV-------NYYGDLRFVQYGITSFGDIECRSPSIYTDLS 266

  Fly   232 YHRAFIAQAV 241
            .:..:|...|
  Fly   267 TYSGWINMVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 61/240 (25%)
Tryp_SPc 38..237 CDD:214473 60/238 (25%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 61/254 (24%)
Tryp_SPc 42..275 CDD:238113 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.