DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG43125

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:213 Identity:50/213 - (23%)
Similarity:75/213 - (35%) Gaps:83/213 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLQLILLAIAVRW-GDALHRGIPVQQQNYGYVMQIYGP-------------QFLAAGSLFSARYV 57
            :|:|.:.|:.:.: |.||     ..:||.| ...::.|             .....|:|.:.|:|
  Fly     4 TLRLAVFALLLFYQGSAL-----FLEQNCG-KSSVFSPAPWLVKIRPELSSNITCTGTLINERFV 62

  Fly    58 LTVAHCFKKNTKPEELSVRAGYRWIAWEFRGK------------QVAGLLRHPKFSPLTLRNDIA 110
            ||.|.|....|   ||.||.|      |..|.            .||..|.|..:|..:.:.:||
  Fly    63 LTAASCIDYQT---ELIVRLG------EIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIA 118

  Fly   111 VLRVKAAISHSHMI------------------------------NYIGLCSRPLT-PLNMFA--- 141
            :||:|.::.:...|                              |..|:..|.|. .|::|.   
  Fly   119 LLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVRE 183

  Fly   142 -------PPQELA-GWNL 151
                   |||.:| ||.|
  Fly   184 PRPDVILPPQPIAVGWPL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 41/181 (23%)
Tryp_SPc 38..237 CDD:214473 41/181 (23%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.