DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and PIK3IP1

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_443112.2 Gene:PIK3IP1 / 113791 HGNCID:24942 Length:263 Species:Homo sapiens


Alignment Length:105 Identity:22/105 - (20%)
Similarity:30/105 - (28%) Gaps:41/105 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 PEKNCRQWFPQISGGVICASATMGEG---------------LCY--GDSGDPLISGGEVCGLAIA 214
            |...|..|....||  :.::...|.|               .||  |::|.|            .
Human    42 PGLRCLNWLDAQSG--LASAPVSGAGNHSYCRNPDEDPRGPWCYVSGEAGVP------------E 92

  Fly   215 FRKCGDKRYPALFTDVHYHRAFIAQAVLTLDREMLSKSRG 254
            .|.|.|.|.|..          .:||:.....|:...|.|
Human    93 KRPCEDLRCPET----------TSQALPAFTTEIQEASEG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 17/88 (19%)
Tryp_SPc 38..237 CDD:214473 17/86 (20%)
PIK3IP1NP_443112.2 KR 22..102 CDD:238056 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.