DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and Try5

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:240 Identity:59/240 - (24%)
Similarity:110/240 - (45%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLILLAIAVRW----GDALHRGIPVQQQNYGYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNT 68
            |.|.|:..||.:    .|.:..|...::.:..|.:.:........|||.:.::|::.|||:|   
Mouse     5 LFLALVGAAVAFPVDDDDKIVGGYTCRENSIPYQVSLNSGYHFCGGSLINDQWVVSAAHCYK--- 66

  Fly    69 KPEELSVRAGYRWIAWEFRGKQV---AGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLC 130
              ..:.||.|...|......:|.   |.:::||.|:..||.|||.::::.:.::.:..:..:.|.
Mouse    67 --TRIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVALP 129

  Fly   131 SRPLTPLNMFAPPQE---LAGW-NLMH--IAQP--LKSMSVQVEPEKNCRQWFP-QISGGVICAS 186
            |       ..||...   ::|| |.:.  :..|  |:.:...:.|:.:|...:| :|:..:||..
Mouse   130 S-------SCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKITNNMICVG 187

  Fly   187 -ATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALFTDV 230
             ...|:..|.||||.|::..|::.|:......|..|..|.::|.|
Mouse   188 FLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/206 (25%)
Tryp_SPc 38..237 CDD:214473 51/206 (25%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 53/222 (24%)
Tryp_SPc 24..242 CDD:238113 53/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.