DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and CG42694

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:95/239 - (39%) Gaps:54/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GIPVQQQNY--------GYVMQI-YGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGY-- 79
            |.|:..|:.        |::..| .|...|.:|||.|.::||:.|.|...:.|   |.|:.|.  
  Fly    28 GAPISNQSITKLRQPQAGWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGK---LFVQLGVSN 89

  Fly    80 -----RWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNM 139
                 .|..       |:.:: .|..|...|:.||.:|::..::.::..:..|.:.....| |:|
  Fly    90 ATKSPHWYT-------VSNVV-IPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNT-LDM 145

  Fly   140 FAPPQEL--AGWNLMHIAQPLKSMSVQVEPEKNCRQWFPQISGGV----ICASATMGEGLCYGDS 198
            ....|..  :.| |.....|...:..|:..:: |:.   .:||.|    |||::......|:.||
  Fly   146 VKILQNFTTSAW-LSKNKNPQTIVLSQLSRDR-CKL---NLSGNVTPKEICAASLQRNNSCFIDS 205

  Fly   199 G----DPLISGGEVC--------GLAIAFRKCGDKRYPALFTDV 230
            |    .|:|.|..:.        |.......|.:   ||::.||
  Fly   206 GSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSE---PAIYIDV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 52/219 (24%)
Tryp_SPc 38..237 CDD:214473 52/219 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 52/221 (24%)
Tryp_SPc 46..253 CDD:214473 52/221 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.