DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11664 and plaua

DIOPT Version :9

Sequence 1:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:235 Identity:57/235 - (24%)
Similarity:102/235 - (43%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GPQFLAAGSLFSARYVLTVAHCFK--KNTKPEELSVRAGYRWIAWEFRGKQ----VAGLLRHPKF 100
            |..|:..|:|.:..:|||.||||.  |.|:....||..|...|......|:    |:.|:.|..|
Zfish   184 GDGFICGGTLITPCWVLTAAHCFPTGKRTQINRYSVVLGKNAINETDPVKEQKFTVSRLVIHEDF 248

  Fly   101 --SPLTLRNDIAVLRVKAAISHSHMINYIGLCS--------------RPLTPLNMFAPPQELAGW 149
              |.....:|||:|:::         :..|.|:              :.:.|:..:.   |:||:
Zfish   249 DYSTENYTHDIALLKIE---------DCNGQCAVKTKTVRTACLPPFQQMLPVGFYC---EIAGY 301

  Fly   150 -----NLMHIAQPLKSMSVQVEPEKNCRQWF---PQISGGVICASA-TMGEGLCYGDSGDPLISG 205
                 .....::.||...|::..:|.|::.:   .:::..::||:. ......|.||||.||:. 
Zfish   302 GRYQKGTFKFSRYLKQTEVKLISQKVCQRTYYNKDEVNENMLCANGRDWKTDACQGDSGGPLVC- 365

  Fly   206 GEVCGLAIAF------RKCGDKRYPALFTDVHYHRAFIAQ 239
             ||..:...|      ::|.:|..|.::|.|..:..:|:|
Zfish   366 -EVNNIMFLFGIISWGKECAEKNQPGVYTQVSNYNQWISQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 56/233 (24%)
Tryp_SPc 38..237 CDD:214473 55/231 (24%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.