DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43867 and AT5G05710

DIOPT Version :10

Sequence 1:NP_001284762.1 Gene:CG43867 / 31031 FlyBaseID:FBgn0264449 Length:1852 Species:Drosophila melanogaster
Sequence 2:NP_196190.1 Gene:AT5G05710 / 830455 AraportID:AT5G05710 Length:144 Species:Arabidopsis thaliana


Alignment Length:101 Identity:37/101 - (36%)
Similarity:52/101 - (51%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   943 EKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQR--KPQGQIQLDEVCRINRAEGA---- 1001
            |:.|.|.|.|..:||||:||||||.|.| :|....||.|  :|:|.:.::.......||..    
plant    29 ERTGWLTKQGEYIKTWRRRWFVLKQGKL-FWFKDSDVTRVSRPRGVVPVESCLTAKGAEDVLNKQ 92

  Fly  1002 STFEIDTGKKVYYLTADSHATMDDWIR-----VLQN 1032
            :.||:.|..:..|..|||....:|||.     ::||
plant    93 NAFELSTRNETMYFIADSEKEKEDWINSIGRSIVQN 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43867NP_001284762.1 TPH 395..>462 CDD:464007
PH1_PLEKHH1_PLEKHH2 944..1039 CDD:241436 36/100 (36%)
PH 1050..1151 CDD:214574
MyTH4 1191..1410 CDD:214535
FERM_F1_Max1_like 1420..1520 CDD:340614
B41 1423..1643 CDD:214604
PH-like 1639..1741 CDD:473070
AT5G05710NP_196190.1 PH_AtPH1 30..135 CDD:270095 36/100 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.