DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43867 and PH1

DIOPT Version :9

Sequence 1:NP_001284762.1 Gene:CG43867 / 31031 FlyBaseID:FBgn0264449 Length:1852 Species:Drosophila melanogaster
Sequence 2:NP_565687.1 Gene:PH1 / 817520 AraportID:AT2G29700 Length:145 Species:Arabidopsis thaliana


Alignment Length:92 Identity:31/92 - (33%)
Similarity:47/92 - (51%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   943 EKMGHLAKLGGKLKTWRKRWFVLKNGSLNYWKSQHDVQRK---PQGQIQLDEVCRINRAEGA--- 1001
            |:.|.|.|.|..:||||:||||||.|.|.::|.|.....:   |:|.|.:.:...:..||..   
plant    28 ERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFKDQAAAGIRGSTPRGVISVGDCLTVKGAEDVVNK 92

  Fly  1002 -STFEIDTGKKVYYLTADSHATMDDWI 1027
             ..||:.:|....:..||:....::||
plant    93 PFAFELSSGSYTMFFIADNEKEKEEWI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43867NP_001284762.1 PH 942..1035 CDD:278594 31/92 (34%)
PH1_PLEKHH1_PLEKHH2 944..1039 CDD:241436 30/91 (33%)
PH 1050..1151 CDD:214574
PH 1053..1151 CDD:278594
MyTH4 1191..1410 CDD:214535
B41 1423..1643 CDD:214604
FERM_M 1527..1643 CDD:278785
PH-like 1639..1741 CDD:302622
PH1NP_565687.1 PH_AtPH1 29..136 CDD:270095 30/91 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3626
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3046
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.