DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and SEC22C

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_116752.1 Gene:SEC22C / 9117 HGNCID:16828 Length:303 Species:Homo sapiens


Alignment Length:172 Identity:51/172 - (29%)
Similarity:74/172 - (43%) Gaps:24/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IARVIDGLPLVGT-----MQDDEQVPSGRSILDYQNQAKMLFRKLGTHSPARCSIETGPYLFHYL 66
            :.||.|||||..:     .||         .|:::.:.|.|..:|..: |.|.|.|...:..|:.
Human     9 VVRVRDGLPLSASTDFYHTQD---------FLEWRRRLKSLALRLAQY-PGRGSAEGCDFSIHFS 63

  Fly    67 IENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRR-VNSVTRPYAFIEFDVYIQKAKKQLTD 130
            ...||..:.:........:||.:||.|..||.|:|... :...:|||||:|||..|||.|...  
Human    64 SFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHF-- 126

  Fly   131 RRRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQN 172
            ...:.|.:...|:.:|..:      .||...||...||...|
Human   127 NYVSSSQMECSLEKIQEEL------KLQPPAVLTLEDTDVAN 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 50/169 (30%)
Longin 39..105 CDD:290490 19/66 (29%)
R-SNARE_SEC22 132..195 CDD:277219 10/41 (24%)
SEC22CNP_116752.1 Longin 42..114 CDD:316307 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D903466at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.