DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and YKT6

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_012725.1 Gene:YKT6 / 853638 SGDID:S000001679 Length:200 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:40/146 - (27%)
Similarity:69/146 - (47%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 THSPARCSIETGPYLFH-YLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRR----VNS 107
            |.:..|.|||.|.|:.| |.....:|.:::.||.|..|.|:..|..:..|:...:.:.    |..
Yeast    51 TGAGQRQSIEEGNYIGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTE 115

  Fly   108 VTRPYAFIEFDVYIQKAKKQLTDRRRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQN 172
            ........:.|.||  :|.|...:...|..:..:|.:.:.::.:.|::|||||..|..|..|:::
Yeast   116 TNDALKMKQLDTYI--SKYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSES 178

  Fly   173 LSMMSQKYKKDAKLLN 188
            |:..|:.:.|.||..|
Yeast   179 LTASSKMFYKQAKKSN 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 40/146 (27%)
Longin 39..105 CDD:290490 17/61 (28%)
R-SNARE_SEC22 132..195 CDD:277219 17/57 (30%)
YKT6NP_012725.1 SNC1 3..200 CDD:227472 40/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.