DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and SEC22

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_172653.1 Gene:SEC22 / 837737 AraportID:AT1G11890 Length:218 Species:Arabidopsis thaliana


Alignment Length:216 Identity:92/216 - (42%)
Similarity:129/216 - (59%) Gaps:7/216 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALLTMIARVIDGLPLVGTMQDDEQVPSGRSILDYQNQAKMLFRKL--GTHSPARCSIETGPYLF 63
            |..:|:||||.|||||...:.|...:|....   |:.|.|.||:.|  |.:..:|.|:|||||:|
plant     1 MVKMTLIARVTDGLPLAEGLDDGRDLPDSDM---YKQQVKALFKNLSRGQNDASRMSVETGPYVF 62

  Fly    64 HYLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRRVNSVTRPYAFIEFDVYIQKAKKQL 128
            ||:||..||||.|.|:.|.|:|||.|||||..||....|..:.:..||||||:||.:|||.||..
plant    63 HYIIEGRVCYLTMCDRSYPKKLAFQYLEDLKNEFERVNGPNIETAARPYAFIKFDTFIQKTKKLY 127

  Fly   129 TDRR--RNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLLNRKS 191
            .|.|  |||:.:|.:|.:|.:||.:|:.:||..|..|.::...:..|:..|:.|...||.|||::
plant   128 QDTRTQRNIAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSEMSSRLTSESRIYADKAKDLNRQA 192

  Fly   192 MYVKAMALGMILLVFIMYFWV 212
            :..|...:.::..|..:.|||
plant   193 LIRKWAPVAIVFGVVFLLFWV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 82/185 (44%)
Longin 39..105 CDD:290490 36/67 (54%)
R-SNARE_SEC22 132..195 CDD:277219 22/64 (34%)
SEC22NP_172653.1 Longin 3..127 CDD:341428 63/126 (50%)
R-SNARE_SEC22 133..196 CDD:277219 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2529
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3597
Inparanoid 1 1.050 171 1.000 Inparanoid score I1538
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D903466at2759
OrthoFinder 1 1.000 - - FOG0004133
OrthoInspector 1 1.000 - - oto2900
orthoMCL 1 0.900 - - OOG6_101898
Panther 1 1.100 - - LDO PTHR45837
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3400
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.