DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and AT5G52270

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001331102.1 Gene:AT5G52270 / 835303 AraportID:AT5G52270 Length:227 Species:Arabidopsis thaliana


Alignment Length:222 Identity:63/222 - (28%)
Similarity:114/222 - (51%) Gaps:23/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALLTMIARVIDGLPLVGTMQDDEQV--PSGRSILDYQNQAKMLFRKLGTHS--PARCSIETGPY 61
            |..||::.||.|||||.   ||...|  ....|.|.|:.||:.|.:::...|  ..:.:|....:
plant     1 MVKLTIVGRVEDGLPLA---QDQTYVNQEDNTSFLLYKQQAEFLLKQVSKDSLLHPKMTILLDHH 62

  Fly    62 LFHYLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEF-HANYGRRVNSVTRPYAFIEFDVYIQKAK 125
            .||:|:|..:||:.:.|..|.::|.||||::|.:|. ..:....:..:::||:||.|...|.:.:
plant    63 SFHFLVEKKICYIALSDSSYPRKLLFNYLQNLNKELDKLDEKALIQKISKPYSFIRFGKIIGRIR 127

  Fly   126 KQLTDRR--RNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMM-----SQKYKKD 183
            ||..|.|  .|:|.:|...:....::.::::|::||..:|..|:..:.:..|:     |.:..:|
plant   128 KQYIDTRTQANLSKLNALRKQELDVVTEHLNDIIQRQQILETLEKASSDPPMIVSTIWSSRCLQD 192

  Fly   184 AKLLNRKSMYVKAMALGMILLVFIMYF 210
            ..|        |...:.:|:||.::.|
plant   193 ISL--------KWTPVTIIILVILVLF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 54/193 (28%)
Longin 39..105 CDD:290490 19/68 (28%)
R-SNARE_SEC22 132..195 CDD:277219 13/69 (19%)
AT5G52270NP_001331102.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D903466at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45837
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.