DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and Sec22c

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_038938688.1 Gene:Sec22c / 687022 RGDID:1590146 Length:306 Species:Rattus norvegicus


Alignment Length:207 Identity:58/207 - (28%)
Similarity:92/207 - (44%) Gaps:18/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALLTMIARVIDGLPLVGTMQDDEQVPSGRSILDYQNQAKMLFRKLGTHSPARCSIETGPYLFHY 65
            |.|...|.||.|||||..:    ......:..|:.:.|.|.|.::|..| |.|.|.|:..:..::
  Rat     3 MILFASIVRVRDGLPLSAS----TDFYHAQEFLECRRQLKALAQRLAQH-PGRGSAESCDFRIYF 62

  Fly    66 LIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRR-VNSVTRPYAFIEFDVYIQKAKKQLT 129
            |...||..:.:..:.....:||.:||.|..:|.|:|... :...:|||.|:|||..|||.|... 
  Rat    63 LSSGDVACMAICSRQCPAAMAFCFLEALWWDFIASYDTTCIGLASRPYTFLEFDSVIQKTKWHF- 126

  Fly   130 DRRRNISNINTQLQDVQRIMVQNIDDVLQ-RGTVLAELDTKTQNLSMMSQKYKKDAKLLNRKSMY 193
             ...:.|.:.:.|:.:|..:......|:. .||     |.....|:..:..:.:.|..|..|.: 
  Rat   127 -NHMSSSQMKSGLEKIQEELKSQPPAVVSLEGT-----DVANGLLNGHAPAHSEPAPNLRMKPV- 184

  Fly   194 VKAMALGMILLV 205
               .|||::.||
  Rat   185 ---TALGVLSLV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 49/183 (27%)
Longin 39..105 CDD:290490 19/66 (29%)
R-SNARE_SEC22 132..195 CDD:277219 11/63 (17%)
Sec22cXP_038938688.1 Longin 5..123 CDD:341428 40/122 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D903466at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.