DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and VAMP7

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001172112.1 Gene:VAMP7 / 6845 HGNCID:11486 Length:260 Species:Homo sapiens


Alignment Length:132 Identity:33/132 - (25%)
Similarity:59/132 - (44%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QVPSGRSILDYQNQAKMLFRKLGTHSPARCSIETGPYLFHYLIENDVCYLVMVDKMYSKRLAFNY 89
            ::||..:.|.|.:                     |.|||||:.::.:.||.:.|..:.:..|||:
Human    35 KIPSENNKLTYSH---------------------GNYLFHYICQDRIVYLCITDDDFERSRAFNF 78

  Fly    90 LEDLAQEFHANYGRRVNSVTRPYAF-IEFDVYIQKAKKQLTDRR--RNISNINTQLQDVQRIMVQ 151
            |.::.:.|...||.|..:.. |||. .||...:....|..::.:  ..:.....|:.:::.|||:
Human    79 LNEIKKRFQTTYGSRAQTAL-PYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVR 142

  Fly   152 NI 153
            ||
Human   143 NI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 33/132 (25%)
Longin 39..105 CDD:290490 16/65 (25%)
R-SNARE_SEC22 132..195 CDD:277219 6/24 (25%)
VAMP7NP_001172112.1 Longin 29..104 CDD:316307 24/90 (27%)
SNARE 124..>144 CDD:328933 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.