DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and Ykt6

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_062635.2 Gene:Ykt6 / 56418 MGIID:1927550 Length:198 Species:Mus musculus


Alignment Length:155 Identity:38/155 - (24%)
Similarity:76/155 - (49%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKMLFRKLGTHSPARCSIETGPYLFHYLIEND-VCYLVMVDKMYSKRLAFNYLEDLAQEFHANYG 102
            ::::..:.|..|  |.|::...||.|..:.:| :..:|:.|..|..|:||..||.:..||    .
Mouse    44 SQLIVERSGKGS--RASVKEQEYLCHVYVRSDSLAGVVIADSEYPSRVAFTLLEKVLDEF----S 102

  Fly   103 RRVNSVTRPY---AFIEFDVYIQKAKKQLTDRRRN-ISNINTQLQDVQRIMVQNIDDVLQRGTVL 163
            ::|:.:..|.   |.|::........|....|..: :|.:..:|.:.:.|:...::.:|:||..|
Mouse   103 KQVDRIDWPVGSPATIQYTGLDDHLSKYQNPREADPMSKVQAELDETKIILHNTMESLLERGEKL 167

  Fly   164 AELDTKTQNLSMMSQKYKKDAKLLN 188
            .:|.:|::.|...|:.:.|.|:..|
Mouse   168 DDLVSKSEVLGTQSKAFYKTARKQN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 38/155 (25%)
Longin 39..105 CDD:290490 18/66 (27%)
R-SNARE_SEC22 132..195 CDD:277219 14/58 (24%)
Ykt6NP_062635.2 SNC1 3..198 CDD:227472 38/155 (25%)
Longin 44..107 CDD:290490 19/68 (28%)
R-SNARE_YKT6 136..195 CDD:277220 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.