DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and vamp1a

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_998563.1 Gene:vamp1a / 406707 ZFINID:ZDB-GENE-040426-2725 Length:119 Species:Danio rerio


Alignment Length:92 Identity:30/92 - (32%)
Similarity:47/92 - (51%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LTDRRRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLL----- 187
            ||..|| :.....|:.:|..||..|:|.||:|...|:|||.:...|...:.:::..|..|     
Zfish    29 LTSNRR-LQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYW 92

  Fly   188 --NRKSMYVKAMALGMILL-VFIMYFW 211
              |.|.|.:..: :|:||| :..|||:
Zfish    93 WKNMKMMIIMGI-MGIILLGIAFMYFY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 22/70 (31%)
Longin 39..105 CDD:290490
R-SNARE_SEC22 132..195 CDD:277219 21/69 (30%)
vamp1aNP_998563.1 Synaptobrevin 31..>97 CDD:279324 19/66 (29%)
R-SNARE_VAMP2 33..95 CDD:277223 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.