DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and sybl1

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_005157192.1 Gene:sybl1 / 393236 ZFINID:ZDB-GENE-040426-1055 Length:220 Species:Danio rerio


Alignment Length:228 Identity:66/228 - (28%)
Similarity:105/228 - (46%) Gaps:39/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALL--------TMIAR--VIDGLPLVGTMQDDEQVPSGRSILDYQNQAKMLFRKLGTHSPARCS 55
            ||:|        |::|:  ...|..|..|.|...::||..:.|.|.:                  
Zfish     1 MAILFAVVARGSTVLAKHACFSGNFLEVTEQILAKIPSENNKLTYSH------------------ 47

  Fly    56 IETGPYLFHYLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRRVNSVTRPYAF-IEFDV 119
               |.|||||:....:.||.:.|..:.:..||.:|.::.:.|...||.|..:.. |||. .||..
Zfish    48 ---GSYLFHYICHERIVYLCITDDEFERSRAFGFLNEVKKRFQTTYGSRAQTAL-PYAMNSEFSS 108

  Fly   120 YIQKAKKQLTDRRRNISNINTQLQ--DVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKK 182
            .:....|..:|.:.:.....||:|  |::.|||:|||.|.|||..|..|..||:||...|..:|.
Zfish   109 TLAAQMKHHSDPKGSDRLTETQMQVDDLKGIMVRNIDLVAQRGERLELLIDKTENLMDSSVTFKT 173

  Fly   183 DAKLLNRKSMYVKAMALGMILLV---FIMYFWV 212
            .::.| ..:|.:|.:.|.:|:::   .::||.|
Zfish   174 TSRNL-AHAMCMKNLKLTVIVVIVVLVVLYFIV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 54/184 (29%)
Longin 39..105 CDD:290490 15/65 (23%)
R-SNARE_SEC22 132..195 CDD:277219 24/64 (38%)
sybl1XP_005157192.1 SNC1 1..172 CDD:227472 57/192 (30%)
Longin 29..98 CDD:290490 22/89 (25%)
Synaptobrevin 122..210 CDD:279324 30/85 (35%)
R-SNARE_VAMP7 124..188 CDD:277224 25/64 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.