DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and Syb

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001137633.1 Gene:Syb / 36080 FlyBaseID:FBgn0003660 Length:152 Species:Drosophila melanogaster


Alignment Length:104 Identity:26/104 - (25%)
Similarity:51/104 - (49%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DVYIQKAKKQLTDR---RRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQK 179
            |.|.|....|:.:.   ::.:.....::.:|..||..|::.||:|...|:||..:...|...:.:
  Fly    28 DNYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQ 92

  Fly   180 YKKDAKLLNRKSMY--VKAM-ALGMI----LLVFIMYFW 211
            :::.|..|.||..:  :|.| .||:|    |::.::..|
  Fly    93 FEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVW 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 19/76 (25%)
Longin 39..105 CDD:290490
R-SNARE_SEC22 132..195 CDD:277219 15/64 (23%)
SybNP_001137633.1 Synaptobrevin 44..130 CDD:395764 21/85 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.