DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and sec22bb

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001315455.1 Gene:sec22bb / 327277 ZFINID:ZDB-GENE-030131-5488 Length:219 Species:Danio rerio


Alignment Length:219 Identity:125/219 - (57%)
Similarity:157/219 - (71%) Gaps:6/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALLTMIARVIDGLPLVGTMQDDEQ--VPSGRSILDYQNQAKMLFRKLGTHSPARCSIETGPYLF 63
            |.|||||||:.|||||..:||:|||  ...||.:..||:|||.|||||...||.||::|.|...|
Zfish     1 MVLLTMIARLADGLPLAASMQEDEQGSEKMGRDLQQYQSQAKQLFRKLNEQSPNRCTLEAGSMSF 65

  Fly    64 HYLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRRVNSVTRPYAFIEFDVYIQKAKKQL 128
            ||:||..|||||:.:..:.|:|||.|||||..|||..:|::|.:|:|||:|||||.||||.||..
Zfish    66 HYVIEKGVCYLVLCEAGFPKKLAFAYLEDLQAEFHEQHGKKVPTVSRPYSFIEFDTYIQKTKKSY 130

  Fly   129 TD--RRRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLLNRKS 191
            .|  .|||:|||||:|||||||||.||::|||||..|:.||:|..|||.:|:||:.|||.||.:|
Zfish   131 IDSRARRNLSNINTELQDVQRIMVANIEEVLQRGEALSALDSKASNLSSLSKKYRSDAKYLNTRS 195

  Fly   192 MYVKAMALGMILLVFIMY--FWVL 213
            .|.|..|.|:..::.|:|  ||.|
Zfish   196 TYAKLAAGGVFFIMLIVYIRFWWL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 107/185 (58%)
Longin 39..105 CDD:290490 36/65 (55%)
R-SNARE_SEC22 132..195 CDD:277219 41/62 (66%)
sec22bbNP_001315455.1 SNC1 12..192 CDD:227472 105/179 (59%)
Longin 41..107 CDD:290490 36/65 (55%)
R-SNARE_SEC22 136..199 CDD:277219 41/62 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595885
Domainoid 1 1.000 102 1.000 Domainoid score I6800
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3597
Inparanoid 1 1.050 245 1.000 Inparanoid score I3263
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D569556at33208
OrthoFinder 1 1.000 - - FOG0004133
OrthoInspector 1 1.000 - - otm25842
orthoMCL 1 0.900 - - OOG6_101898
Panther 1 1.100 - - LDO PTHR45837
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6269
SonicParanoid 1 1.000 - - X3400
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.