DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and Sec22b

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_035472.1 Gene:Sec22b / 20333 MGIID:1338759 Length:215 Species:Mus musculus


Alignment Length:217 Identity:122/217 - (56%)
Similarity:157/217 - (72%) Gaps:6/217 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALLTMIARVIDGLPLVGTMQDDEQVPSGRSILDYQNQAKMLFRKLGTHSPARCSIETGPYLFHY 65
            |.||||||||.|||||..:||:|||  |||.:..||:|||.|||||...||.||::|.|...|||
Mouse     1 MVLLTMIARVADGLPLAASMQEDEQ--SGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHY 63

  Fly    66 LIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRRVNSVTRPYAFIEFDVYIQKAKKQLTD 130
            :||..|||||:.:..:.|:|||.|||||..||...:|::|.:|:|||:|||||.:|||.||...|
Mouse    64 IIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYID 128

  Fly   131 --RRRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLLNRKSMY 193
              .|||:.:|||:|||||||||.||::|||||..|:.||:|..|||.:|:||::|||.||.:|.|
Mouse   129 SRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTY 193

  Fly   194 VKAMALGMILLVFIMY--FWVL 213
            .|..|:.:..::.|:|  ||.|
Mouse   194 AKLAAVAVFFIMLIVYVRFWWL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 105/183 (57%)
Longin 39..105 CDD:290490 35/65 (54%)
R-SNARE_SEC22 132..195 CDD:277219 39/62 (63%)
Sec22bNP_035472.1 Longin 3..126 CDD:341428 74/124 (60%)
R-SNARE_SEC22 132..195 CDD:277219 39/62 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850042
Domainoid 1 1.000 101 1.000 Domainoid score I6955
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3597
Inparanoid 1 1.050 240 1.000 Inparanoid score I3339
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004133
OrthoInspector 1 1.000 - - oto92278
orthoMCL 1 0.900 - - OOG6_101898
Panther 1 1.100 - - LDO PTHR45837
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6269
SonicParanoid 1 1.000 - - X3400
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.