DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and sec-22

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_508198.1 Gene:sec-22 / 180456 WormBaseID:WBGene00018853 Length:214 Species:Caenorhabditis elegans


Alignment Length:207 Identity:93/207 - (44%)
Similarity:140/207 - (67%) Gaps:3/207 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTMIARVIDGLPLVGTMQDDEQVPSGRSILDYQNQAKMLFRKLGTHSPARCSIETGPYLFHYLIE 68
            ||:||||.|||.|..:::.:.......|::.|.|||||||:|| ..:||:.|:|:||::|||:|.
 Worm     3 LTLIARVRDGLILATSIEGNNDGSGDSSMVKYSNQAKMLFKKL-NGAPAQQSVESGPFVFHYIIV 66

  Fly    69 NDVCYLVMVDKMYSKRLAFNYLEDLAQEFHANYGRRVNSVTRPYAFIEFDVYIQKAKKQLTDRRR 133
            .::|.||:.|:.:.:::||.||.|:.|||......|:..|.|||.|:|||.|||:||::..|..:
 Worm    67 QNICALVLCDRNFPRKVAFQYLSDIGQEFLNENSSRIEQVVRPYHFLEFDKYIQQAKQRYGDTNK 131

  Fly   134 NISN-INTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLLNRKSMYVK-A 196
            :..| ::.:||||.||||.||:||:.||..|..|:.:...||.||:||:.|||.|||:|...| |
 Worm   132 HAMNTVSNELQDVTRIMVTNIEDVIHRGEALNILENRASELSGMSKKYRDDAKALNRRSTIFKVA 196

  Fly   197 MALGMILLVFIM 208
            .::|:..::|:|
 Worm   197 ASIGIAGVLFLM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 82/182 (45%)
Longin 39..105 CDD:290490 29/65 (45%)
R-SNARE_SEC22 132..195 CDD:277219 30/63 (48%)
sec-22NP_508198.1 Longin 38..103 CDD:290490 29/65 (45%)
R-SNARE_SEC22 131..194 CDD:277219 30/62 (48%)
Synaptobrevin 134..214 CDD:279324 35/75 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167213
Domainoid 1 1.000 86 1.000 Domainoid score I5198
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3597
Inparanoid 1 1.050 179 1.000 Inparanoid score I2679
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53513
OrthoDB 1 1.010 - - D569556at33208
OrthoFinder 1 1.000 - - FOG0004133
OrthoInspector 1 1.000 - - oto19484
orthoMCL 1 0.900 - - OOG6_101898
Panther 1 1.100 - - LDO PTHR45837
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6269
SonicParanoid 1 1.000 - - X3400
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.