DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec22 and vamp7

DIOPT Version :9

Sequence 1:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_031746113.1 Gene:vamp7 / 100216181 XenbaseID:XB-GENE-963013 Length:224 Species:Xenopus tropicalis


Alignment Length:193 Identity:54/193 - (27%)
Similarity:95/193 - (49%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QVPSGRSILDYQNQAKMLFRKLGTHSPARCSIETGPYLFHYLIENDVCYLVMVDKMYSKRLAFNY 89
            ::||..:.|.|.:                     |.|||||:.::.:.||.:.|..:.:..|||:
 Frog    39 KIPSENNKLTYSH---------------------GSYLFHYICQDRIIYLCITDDDFERSRAFNF 82

  Fly    90 LEDLAQEFHANYGRRVNSVTRPYAF-IEFDVYIQKAKKQLTDRRR--NISNINTQLQDVQRIMVQ 151
            |.::.:.|...||.|..:.. |||. .||...|....|..::.:.  .::....|:.:::.|||:
 Frog    83 LNEIKKRFQTTYGSRAQTAL-PYAMNSEFSSVIAAQLKYHSENKSIDRVAETQAQVDELKGIMVR 146

  Fly   152 NIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLLNRKSMYVKAMALGMIL-LVFIMYFWVL 213
            |||.|.|||..|..|..||::|...|..:|..::.|.| :|.:|.:.|.:|: :|.|:..:::
 Frog   147 NIDLVAQRGERLELLIDKTESLVDSSVTFKTTSRNLAR-AMCMKNLKLTIIIAIVTIVIIYII 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 48/169 (28%)
Longin 39..105 CDD:290490 16/65 (25%)
R-SNARE_SEC22 132..195 CDD:277219 21/64 (33%)
vamp7XP_031746113.1 Longin 8..120 CDD:341428 27/102 (26%)
R-SNARE_VAMP7 128..192 CDD:277224 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.