DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13359 and ECP63

DIOPT Version :9

Sequence 1:NP_569861.1 Gene:CG13359 / 31028 FlyBaseID:FBgn0025616 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_181202.1 Gene:ECP63 / 818236 AraportID:AT2G36640 Length:448 Species:Arabidopsis thaliana


Alignment Length:294 Identity:73/294 - (24%)
Similarity:119/294 - (40%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 KTLQTEEA--ERRKLIIDKANSARNLTIDKANSARILAIDKATSARKLTIDNSTSAGTLTIDKAT 233
            ||.:..|:  |..::..:||..|::.|::||........:|....:..|:|.:..|...|.:||.
plant    76 KTHEAAESTKEGAQIASEKAVGAKDATVEKAKETADYTAEKVGEYKDYTVDKAKEAKDTTAEKAK 140

  Fly   234 NARKLTIDKGTSARKLTIDKATSARKLTIDKATSARKMTIDKAKSTRNLTIDNATSARKLTIEKA 298
            .....|.||...|:..|.:|....:...:|||..|:..|.:|||.|.|.|.|.|..|:..|.||.
plant   141 ETANYTADKAVEAKDKTAEKIGEYKDYAVDKAVEAKDKTAEKAKETANYTADKAKEAKDKTAEKV 205

  Fly   299 TSARKMTIDKAKSTRNLTIDNATSA-----------RKLTIEKATSARRFSRPK----------- 341
            ...:..|:|||...|:.|.:.|..|           :..|:||||..:..:..|           
plant   206 GEYKDYTVDKAVEARDYTAEKAIEAKDKTAEKTGEYKDYTVEKATEGKDVTVSKLGELKDSAVET 270

  Fly   342 -RYVSGYISKRKSIGKTESLSRGAYIPDPELNRAIAKYGVSASQPFKRQHCLVLEKHPDRTQIPN 405
             :...|::|     ||||. ::|..:.    .:..||..:..:....||      |..:......
plant   271 AKRAMGFLS-----GKTEE-AKGKAVE----TKDTAKENMEKAGEVTRQ------KMEEMRLEGK 319

  Fly   406 SRTNTSGCKSDGSSTPIWRSARTGADQNTQAESS 439
            .....:|.|:..:|.....|..:||.:..:.:.|
plant   320 ELKEEAGAKAQEASQKTRESTESGAQKAEETKDS 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13359NP_569861.1 None
ECP63NP_181202.1 Neuromodulin_N <81..>354 CDD:331332 71/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3173
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.