DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13359 and bod1

DIOPT Version :9

Sequence 1:NP_569861.1 Gene:CG13359 / 31028 FlyBaseID:FBgn0025616 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001070180.1 Gene:bod1 / 767743 ZFINID:ZDB-GENE-060810-163 Length:157 Species:Danio rerio


Alignment Length:123 Identity:27/123 - (21%)
Similarity:41/123 - (33%) Gaps:39/123 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DCLALRKVRAEMNLADQKAAKNLVDRVEVHHKT-LQTEEAERRKLIIDKANSARNLTIDKANSAR 203
            ||||        ::..:...:||..||..:..| |.|:|...   .|:| |..||........:.
Zfish    41 DCLA--------DVDTKPGYQNLQQRVGTYVSTHLSTQEWNP---TINK-NQVRNALRQSVIQSG 93

  Fly   204 IL--------------------------AIDKATSARKLTIDNSTSAGTLTIDKATNA 235
            :|                          ||.:...|.|.....|.||..:..::.||:
Zfish    94 MLESGVDRIISQVVEPKLQHIFRPIIENAIHEFLDAEKKEEGTSNSAPDVESEEMTNS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13359NP_569861.1 None
bod1NP_001070180.1 COMPASS-Shg1 25..117 CDD:282989 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26132
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.