DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13359 and PLIN4

DIOPT Version :9

Sequence 1:NP_569861.1 Gene:CG13359 / 31028 FlyBaseID:FBgn0025616 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_016882681.1 Gene:PLIN4 / 729359 HGNCID:29393 Length:1433 Species:Homo sapiens


Alignment Length:368 Identity:71/368 - (19%)
Similarity:113/368 - (30%) Gaps:107/368 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 AIDKATSARKLTIDNSTSAGTLTIDKATNARKLTIDKG--TSARKLT---------IDKATSARK 259
            |:.......|..:..:..|.:..:..|.|..|.|:..|  ||...||         :..|.:..|
Human   941 AVQGGLDTTKSVLTGTKDAVSTGLTGAVNLAKGTVQTGVDTSKTVLTGTKDTVCSGVTGAVNVAK 1005

  Fly   260 LTIDKATSARKMTIDKAKSTRNLTIDNATSARKLTIEKATSARKMTIDKAKSTRNLTIDNATSAR 324
            .|:.......|..:..||......:..|.:..|.|::....|.|..:   ..|::......|.| 
Human  1006 GTVQTGVDTAKTVLSGAKDAVTTGVTGAVNVAKGTVQTGVDASKAVL---MGTKDTVFSGVTGA- 1066

  Fly   325 KLTIEKATSARRFSRPKRYVSGYISKRKSI--GKTESLSRGAYIPDPELNRAIAKYGVSASQPFK 387
                        .|..|..|.|.:...|::  |..:::|.| .:....:.......|:|..|.: 
Human  1067 ------------MSMAKGAVQGGLDTTKTVLTGTKDAVSAG-LMGSGNVATGATHTGLSTFQNW- 1117

  Fly   388 RQHCLVLEKHPDRT--QIPNSRTNTSGCKS----------DGSST----------PIWRSART-- 428
                  |...|..:  .:.:|||..:|.:.          .|.||          |.|.:|.|  
Human  1118 ------LPSTPATSWGGLTSSRTTDNGGEQTALSPQEAPFSGISTPPDVLSVGPEPAWEAAATTK 1176

  Fly   429 -----------GAD------------------------QNTQAESSDSFNSSNSFESSSLASDSQ 458
                       ||.                        ||......|.|:..|:.|.:.||:...
Human  1177 GLATDVATFTQGAAPGREDTGLLATTHGPEEAPRLAMLQNELEGLGDIFHPMNAEEQAQLAASQP 1241

  Fly   459 ENHELSTAAG--------LTAAFMRR---HMLFHLLARRFRRR 490
            ....||...|        |..:|.:|   |.:.||...:|:.|
Human  1242 GPKVLSAEQGSYFVRLGDLGPSFRQRAFEHAVSHLQHGQFQAR 1284



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.