DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13359 and EFCAB13

DIOPT Version :9

Sequence 1:NP_569861.1 Gene:CG13359 / 31028 FlyBaseID:FBgn0025616 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_689560.3 Gene:EFCAB13 / 124989 HGNCID:26864 Length:973 Species:Homo sapiens


Alignment Length:156 Identity:35/156 - (22%)
Similarity:66/156 - (42%) Gaps:22/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 IEKATSARRFSRPKRYVSGYISKRKSIGKTESLSRGAYIPDPELNRAIAKYGVSASQPFKRQHCL 392
            :.:.||.|:.|.    |:|...|.|   |..|||  :.:|:|.:::.:.|   .::|.:.:    
Human   300 LNEITSDRKLSS----VAGCYLKYK---KKNSLS--SKLPEPSISKKLNK---KSNQYYSK---- 348

  Fly   393 VLE------KHPDRTQIPNSRTNTSGCKSDGSSTPIWRSARTGADQNTQAESSDSFNSSNSFESS 451
            ::|      |.|..|..........|..:.|...|..::.......:.:.|..||.:...|.:||
Human   349 IMENDDLESKRPKNTWQIRKFLGGVGSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSS 413

  Fly   452 SLASDSQENHELSTAAGLTAAFMRRH 477
            :..|.|.:..::|:...|....:|:|
Human   414 TSLSKSLDKSDISSIPKLQKPAVRKH 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13359NP_569861.1 None
EFCAB13NP_689560.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..448 12/56 (21%)
PTZ00184 448..592 CDD:185504
EFh <471..518 CDD:298682
FRQ1 536..662 CDD:227455
FRQ1 671..825 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5862
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.