DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and CG18765

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:374 Identity:81/374 - (21%)
Similarity:144/374 - (38%) Gaps:66/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SSKRQLDEELALIVKSIAITPATQFLEELAVYLREKIFYFDVLGKLEVLIGDGSK---FGAKCLY 128
            :.|||    ::.::||....|....|.....:..|:..:..||..||.|..:..:   ||...:.
  Fly    65 NKKRQ----VSYLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQ 125

  Fly   129 TTREPIQTIVFDDLTQYGYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEP-SVREHFTTG 192
            ...:. ..|..|.:...||.:|:...||:......:|.||..:||.:.....|.| .:||   ..
  Fly   126 AKLKS-SHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRE---LP 186

  Fly   193 MLDENYIRTNERFINFMTLQCRTLANVVSKWPGYEL-LAEKL-----HRHCDNIK--ENLVTTGR 249
            .|.||.....|      |.:.::|         |:| ..|.|     .::.|.:|  :..|.:|.
  Fly   187 KLRENSKSDEE------TAELKSL---------YQLRFHESLRSNDARQYEDKVKSFQKYVKSGT 236

  Fly   250 PLPGEITVLN---HGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSPGCDI-NFFLNSSVQL 310
            .:....|..|   :|..|.||.:.:.|.....|  |.:|..|..:.:|....|: :..|.:..:.
  Fly   237 EILDSKTSFNVILNGSCWPNNLLLQVDAFGNVK--DTLFSGFHTAQYGPAVYDLFSSLLTAPAEK 299

  Fly   311 DVLIHRREFLIQTYYASLRDSLERMHSAFV---PSYADIQQEIRARELYGFFSSYAFLPMVTMKK 372
            .   .|.:..::.|:..|.::|..:  .|:   ||..|:|.::.....:.|.::...||:|.   
  Fly   300 S---SRFDGYVKFYHDQLIENLNLL--KFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVL--- 356

  Fly   373 EDSYDISIEALSDQDFAKKKVQLMFSSNPRTTDTLRYALRRFDDLGIFD 421
                         .||....::.:| .||...:.:|..|...::.|.|:
  Fly   357 -------------SDFGNNDIEELF-RNPVFGEQIRELLPWMENRGYFE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 63/283 (22%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 63/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459224
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.