DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and CG6908

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:459 Identity:127/459 - (27%)
Similarity:215/459 - (46%) Gaps:74/459 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLDDKQKR-----------LGHEP-PKYLNEDFFKAALEDGLRDMRVDIKKI--IFSESSGGGGE 52
            ||..:|::           :..|| |.:|::..|:..||   ||. .|:|||  ...|.:.|.||
  Fly    23 KLSKQQRQQVNDMVRETEDIAIEPIPAWLDQQKFEPILE---RDF-PDLKKIKSFRLEPTAGKGE 83

  Fly    53 NYCSKIYRAKALYRSSKRQLDEELALIVKSIA-ITPATQFLEELA---VYLREKIFYFDVLGKLE 113
            ||.:.:.||     :.:.:|::.....:..:| |.|.:...|.:|   |:.:|:..|...:.:.|
  Fly    84 NYTTLLLRA-----NFELELNDGSEQSISYMAKILPNSGNRENVASWKVFYKERNTYGQYIPEFE 143

  Fly   114 VLIGDGSK---FGAKCLYTTREPI--QTIVFDDLTQYGYKLASRQSGLNEEHCVVILKKLGKFHA 173
            .:..|..|   ||.: .|.::..:  :.||.:||.:.|::...||:||:.:|....|:||.:|||
  Fly   144 QMYKDAGKKISFGPR-YYESQIELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHA 207

  Fly   174 SSMVLAEKEPSVREHFTTGM------LDENYIRTNERFINFMTLQCRTLANVVSKWPGYEL--LA 230
            :|.|..|.:.|..|.:...:      |.|  :|.|:            |...:..:|.|:.  |.
  Fly   208 ASAVRFELKGSYPEEYNQNLCSVVDSLKE--LRENQ------------LKAYIDAFPLYDASHLT 258

  Fly   231 EKLHRHCDNIKENLVTTGRPLPGEITVLNHGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGS 295
            ..:..:.....:...:....:.||..||||||.|.||.||:||  :..|..:..|||.|.|.|.|
  Fly   259 NDVQAYGSQADDMFQSFAPKIEGEFRVLNHGDAWCNNIMYQYD--EAGKLAEVNFVDLQMSRFSS 321

  Fly   296 PGCDINFFLNSSVQLDVLIHRREFLIQTYYASLRDSLERM-HSAFVPSYADIQQEIRARELYGFF 359
            |..|:.:.:.||.:||:.|.:.::||:.|:..|.:||:.: :...:||...:.|.|   .:||.:
  Fly   322 PAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSI---FIYGDW 383

  Fly   360 ---SSYAFLPMVTMKKEDSYDISIEALSDQDFAKKKVQLMFSSNPRT----TDTLRYALRRFDDL 417
               .....||:|.:...|  |.::::|.|.:.|..|::.....|.|.    .:.|.:|.||    
  Fly   384 ILPIVSILLPLVLIDGGD--DANMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRR---- 442

  Fly   418 GIFD 421
            |.|:
  Fly   443 GAFE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 86/301 (29%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 86/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.