DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and CG13813

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:380 Identity:84/380 - (22%)
Similarity:158/380 - (41%) Gaps:28/380 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SESSGGGGENYCSKIYRAKALYRSSKRQLDEELALIVKSIAITPATQ-FLEELAVYLREKIFYFD 107
            |:...|.|||...::.|.      |...:.:...::||......|.: .:..:..|.||...|..
  Fly    27 SQPMAGVGENAYGQVLRV------SWPTIVDAATVVVKMAPRNEARRSHMHVVDYYAREVFMYQK 85

  Fly   108 VLGKLEVLIGDGSKFG-AKCLYTT--REPIQTIVFDDLTQYGYKLASRQSGLNEEHCVVILKKLG 169
            |......|..|.:.|. |..|...  :.|.:.::|:||::.|::..||......:..|..||.|.
  Fly    86 VFPVFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALA 150

  Fly   170 KFHASSMVLAEKEPSVREHFTTGMLDENYIRTN--ERFINFMTLQCRTLANVVSKWPGYELLA-E 231
            :.||.|.:|.:.:|...:.....:..:|...::  |..|.|...|.|....::.:..|.::.| :
  Fly   151 ELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKESDGDQVAAVQ 215

  Fly   232 KLHRHCDNIKENLV---TTGRPLPGEITVLNHGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFF 293
            ::.:.|:|..::|.   ..|: ......|:.|||.|.||.:|:::... .:|::|..:|||.|.:
  Fly   216 EVLQLCENQLKSLALYCVDGK-AQAPHAVICHGDFWNNNILYRHEPNS-DQPVEAKLIDFQMSRY 278

  Fly   294 GSPGCDINFFLNSSVQLDVLIHRREFLIQTYYASLRDSLERMHSAFVPSY--ADIQQEIRARELY 356
            ..|..||..:|.:..:..:........:..||.::...|:..:.:....|  :...::::...:|
  Fly   279 APPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVY 343

  Fly   357 GFFSSYAFLPMVTMKKEDSYDI--------SIEALSDQDFAKKKVQLMFSSNPRT 403
            |.......||.......:..||        ||...||:...|:.::.....|.||
  Fly   344 GLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEEYEMLNART 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 67/294 (23%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 67/294 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.