DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and CG5126

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:408 Identity:95/408 - (23%)
Similarity:155/408 - (37%) Gaps:79/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KYLNEDFFK-----AALEDGLRDMRVDIKKIIFSESSGGGGENYCSKIYRAKALYRSSKRQLDEE 75
            ::|..|.||     |:||.             .|.....|.:.:.|.:|........::|:..| 
  Fly    13 RHLVYDIFKNFGPSASLES-------------HSVECSNGLDGFMSALYTVTLDVVIAERKRTE- 63

  Fly    76 LALIVKSIAITPATQFLEELAVYLR--EKIF-YFDVLGKLEVLI------GDGSKFGAKCLYTTR 131
             .::||.:..|  .:|.|....|::  .:|| |.::|...|.::      .:..|....|.|..|
  Fly    64 -VVLVKFMKGT--EEFRESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFAR 125

  Fly   132 ----EPI-----QTIVFDDLTQYGYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEPSVRE 187
                |.:     ..:....|...||:|..|.: |..:....::..:|.|||........:|:|..
  Fly   126 FGHVEGLGNGRESVLALKHLKGDGYQLGPRLT-LRRDQLEAMVGLVGPFHALGYATKILQPNVHA 189

  Fly   188 HFTTGMLDENYIRTN-------------ERFINFMTLQCRTLANVVSKWPGY----ELLAEKLHR 235
            ....|::|..::.::             :||..|...|...|.....  ||:    |.|.||..:
  Fly   190 RLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGAD--PGFGAAIERLREKYFK 252

  Fly   236 HCDNIKENLVTTG----RPLPGEITVLNHGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSP 296
            ....:.|.:.|:.    :|.....|.| |||...||.::.|..|.....|.||  |||...|.:.
  Fly   253 QPTLLLERIRTSSFAEDQPDSHFATFL-HGDYNRNNVLFHYGAEDKVDAIKAI--DFQELRFSTT 314

  Fly   297 GCDINFFLNSSVQLDVLIHRREF---LIQTYYASLRDSLE----RMHSAFVPSYAD-IQQEIRAR 353
            ..|::||:..:...:   .|:|.   |::.|:.|:.:.||    |..:.......| :.||....
  Fly   315 AIDLSFFMYMNTPSE---GRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFE 376

  Fly   354 ELYGFFSSYAFL-PMVTM 370
            .....|..|||. |||.|
  Fly   377 RFNAHFKRYAFYGPMVCM 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 75/330 (23%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 74/324 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.