DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and nhr-246

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:262 Identity:64/262 - (24%)
Similarity:99/262 - (37%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SKFGAKCLYTTREPIQTIVFDDLTQYGYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEPS 184
            ||.|.|.      |:..||.:.|..  .||.....|.||:....|:.:|.|.|..|:. .||...
 Worm   124 SKAGEKA------PVPVIVLEMLED--CKLHDLIPGFNEDQLFKIVDELVKLHIFSLT-TEKWKE 179

  Fly   185 VREHFTTGMLDENYIRTNERFINFMTLQC------RTLA-------------NVVSKWPGYELLA 230
            :       :.||:.:..:    .|  |||      |.||             |.:...|.|    
 Worm   180 I-------VPDESKLAMS----GF--LQCMVADVGRKLAQNPELGVILSYVENTLDTDPNY---- 227

  Fly   231 EKLHRHCDNIKENLVTTGRPLPGEITVLNHGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGS 295
                  ...:::..:...||     :|:.|||||....::..:|.      .|..||:|.:..||
 Worm   228 ------LQKMRDEYINEERP-----SVICHGDLWAPQILWDKEDN------IAGIVDWQATHRGS 275

  Fly   296 PGCDINFFLN--SSVQLDVLIHRREF---LIQTYYASLRDSLERMHSAFVPSYADIQQEIRAREL 355
            |..|::..|:  :|||     :|:.|   |:..||..|:..|:........:..:|..|.....:
 Worm   276 PMEDLHHILSTCTSVQ-----NRKTFTKPLLDHYYNKLKVGLKEKGFKTTWTREEIDIEYNYSFI 335

  Fly   356 YG 357
            ||
 Worm   336 YG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 60/238 (25%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 55/221 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.