DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and H06H21.8

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:340 Identity:76/340 - (22%)
Similarity:131/340 - (38%) Gaps:64/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ENYCSKIYRAKALYRSSKRQLDEELALIVKSIAIT-------PATQFLEELAVYL--REKIFY-- 105
            :::.|:||.|.........::.|.:.:.|..|:..       .|...|.::.:|.  :|.:||  
 Worm    37 KSFWSEIYVAHLKVVGDGVKVPESVFIKVPRISENVLRCEDESAVNHLNDVLLYYSKKENLFYKH 101

  Fly   106 FDVLGKLEVLIGDGSKFGAKCLYTTR----EPIQTIVFDDLTQYGYKLASRQSGLNEEHCVVILK 166
            |:        .|....|....:|.|.    |....||.::|::..:.: ....||..|..:.:::
 Worm   102 FE--------YGSIPNFPFPKVYFTEDINGEATGGIVAENLSEKVFAV-EHIPGLKHEQILRLME 157

  Fly   167 KLGKFHASSMVLAEKEPSVREHFTTGMLDENYIRTNERFINFMTLQCRTLANVVSKWPGYELLAE 231
            .|...|  |.::...:.|..|.|..|.......  :|...|.|..:..||.||..:..|.:.:. 
 Worm   158 ALAGLH--SFLMKRDDKSYVESFVEGAHGRETF--SEGMQNMMFEEALTLENVSPEVFGNDRIR- 217

  Fly   232 KLHRHCDNIK-------ENLVTTG--RPLPGEITVLNHGDLWVNNFMYKYD---DEQPTKPIDAI 284
                   |||       :|..|..  ...||   ::.|.||.|.|.::|.|   ||     |.||
 Worm   218 -------NIKWSFDYSIKNKATADAISAFPG---IICHADLNVTNVLWKKDSAKDE-----ISAI 267

  Fly   285 FVDFQNSFFGSPGCDINFFLNSSVQLDVLIHRREFLIQTYYASLRDSLERMHSAFVP-SYADIQQ 348
             :|:|..|.||...||...|...:..::    |..:.|.|......:|..:.:...| |..::..
 Worm   268 -IDYQMLFIGSIAFDIIRVLTLGLNREI----RRKMTQNYLDHYHKTLTELSNGKAPFSMEELLH 327

  Fly   349 EIRARELYGFFSSYA 363
            :...  :|.|.|:::
 Worm   328 QYSL--IYPFSSNFS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 71/309 (23%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 52/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.