DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and E02C12.6

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_505426.2 Gene:E02C12.6 / 183987 WormBaseID:WBGene00017092 Length:419 Species:Caenorhabditis elegans


Alignment Length:296 Identity:63/296 - (21%)
Similarity:115/296 - (38%) Gaps:82/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DDLTQY-------------GYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEPSVREHFTT 191
            |||..|             .||      .:..::....::.:..|.|.:..|..:|.  :...:|
 Worm   147 DDLKGYLITDFIPNVHVIEAYK------SIPADNIAATIRGIATFSALAEHLEREEQ--KSFMST 203

  Fly   192 GMLD---ENYIRTNERFINFMTLQCR--------TLANVVSKWPGYELLAEKLHRHCDNIKENLV 245
            ..|:   |::....|....|..|:.:        .::.::..:..|:.|.:|.    .||.:   
 Worm   204 DFLELLFEDFFTDAELSKKFEALKTKFEGQQHAEKVSKLIKVFAHYKALVKKY----TNISD--- 261

  Fly   246 TTGRPLPGEITVLNHGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSPGCDINFFLNSSVQL 310
                 |.|...|..|||||.:|.|:..|:.:..| ::|| :|:|:.....||.|:     |.:.|
 Worm   262 -----LLGLKPVFIHGDLWQSNIMFTLDNSKKLK-LEAI-IDWQSVSRIPPGIDL-----SRIML 314

  Fly   311 DVLIHRREFLIQTYYASLRDSLERMHSAFVPSYADIQQEIRARELYGF------FSSYAFLPMVT 369
            ..|             |.::..|| .:..:..|.:...::..:||:.|      ::.||  ||:.
 Worm   315 GCL-------------SAQERRER-GTELLKLYHETYAKVFGKELFTFQELQDSYNLYA--PMMA 363

  Fly   370 M-------KKEDSYDISIE--ALSDQDFAKKKVQLM 396
            |       ...||..||.|  |.:.::...|:|.::
 Worm   364 MLILPSLSSFLDSAQISKEEKAAAAEEVNLKEVAMI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 45/218 (21%)
E02C12.6NP_505426.2 DUF1679 3..410 CDD:369592 63/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.