DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and C29F7.1

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:277 Identity:59/277 - (21%)
Similarity:117/277 - (42%) Gaps:37/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PIQTIV---FDDLTQYGYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEPSVREHFTTGML 194
            |:..||   |:|.|.:     ....|.:::....|:.::...|..|:...|         ...:|
 Worm   139 PVPVIVMEMFEDCTVH-----DLIDGFDKDQLFKIVDEIVNLHIFSLTTEE---------WRSVL 189

  Fly   195 DENYIRTNERFINFMTLQCRTLANVVSKWPGYELLAEKLHRHCDNIKENLVT--TGRPLPGE-IT 256
            .::.:|..   ::......:|:|..::|.||.|::::.:.:..|. ..:.:|  :...|.|: .:
 Worm   190 PDSAMRDT---VDLFEAMVKTIAENMAKSPGLEIISKYIEKTFDK-DPSFMTKFSDEYLEGKRKS 250

  Fly   257 VLNHGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSPGCDINFFLNSSVQLDVLIHRREFLI 321
            ||.|||||....::..||.      .|..:|:|....|||..|::..|::...::......:.|:
 Worm   251 VLTHGDLWSPQILWDKDDN------IAGIIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLL 309

  Fly   322 QTYYASLRDSLERMHSAFVPSYADIQQEIRARELYG----FFSS--YAFLPMV-TMKKEDSYDIS 379
            ..|:..|...||........:..::.:|......||    .||:  ::..|:: |..|.|...||
 Worm   310 DHYFEKLSAGLEEKGVKMPWTREEVDEEYNHCFSYGASITIFSNGIWSSSPILQTDGKPDPARIS 374

  Fly   380 IEALSDQDFAKKKVQLM 396
            ......|.:.::.||::
 Worm   375 ESFARCQSYVEEAVQVL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 45/207 (22%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 43/203 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.