DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and C29F7.2

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans


Alignment Length:241 Identity:53/241 - (21%)
Similarity:97/241 - (40%) Gaps:42/241 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PIQTIV---FDDLTQYGYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEPSVREHFTTGML 194
            |:..||   |:|...|..     .:|.|||....|:.::.|.|..|:...|.:..|.:.|...| 
 Worm   139 PVPVIVMEMFEDCKVYDI-----ITGFNEEQLYKIVDEIVKLHIFSLTTEEWKTIVPDAFVLEM- 197

  Fly   195 DENYIRTNERFINFMTLQCRTLANVVSKWPGYELLAEKLH-------RHCDNIKENLVTTGRPLP 252
             ..|.:|          ....:...:::.||.||::..:.       :...||.:..:...|   
 Worm   198 -AGYFQT----------MVAGIGEKLAQQPGLELVSTYIKNTFATDPKFLQNINDEYLEERR--- 248

  Fly   253 GEITVLNHGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSPGCDINFFLNSSVQLDVLIHRR 317
              |:||.|||||....::..:|:      .|..:|:|.:..|||..|.:..:::...::...:..
 Worm   249 --ISVLTHGDLWAPQILWDKNDD------IAGIIDWQITHRGSPMEDFHHIMSTCTSVENRKNLT 305

  Fly   318 EFLIQTYYASLRDSLERMHSAFVPSYADIQQEIRARELYGFFSSYA 363
            :.|:..|:..|...||........:..:|::|.:    |.|.:..|
 Worm   306 KPLLDYYFDKLSSGLEAKGVKMPWTREEIEEEYK----YSFINGAA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 48/211 (23%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 45/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.