DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13360 and F59B1.8

DIOPT Version :9

Sequence 1:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:269 Identity:68/269 - (25%)
Similarity:104/269 - (38%) Gaps:77/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ILKKLGKFHASSMVLAEKEPSVR-----EHFTTGMLDENYIRTNERFINFMTLQCRTLANVVSKW 223
            |||.|.:..|.|:    ...|.|     |.|...::|    ..:|..:..:..|.|   |:..| 
 Worm   183 ILKALARLQALSL----STESCRNLDNGEAFEESLMD----MLSEDGLKGIFDQSR---NIDQK- 235

  Fly   224 PGYELLAEKLHRHCDNIKE--NLVTT---GRPLPGEITVLNHGDLWVNNFMYKYDDEQPTKPIDA 283
                 |:||:.|...|.||  ||.|.   .:.:..:..|:.|||||..|.::        ...|.
 Worm   236 -----LSEKVERIEQNHKEILNLETVLNLNKVVGIDQKVICHGDLWAANILW--------TQTDG 287

  Fly   284 IFV-----DFQNSFFGSPGCDINFFLNSSVQ-LDVLIHRREFLIQTYYASLRD---------SLE 333
            .|:     |:|.|..|:|..|:...|.|::. .|...| .|.:::.:|....|         :||
 Worm   288 GFIADKVLDYQESHMGNPAEDLVRLLVSTISGADRQSH-WEHILEQFYTYFTDEIGSNNAPYTLE 351

  Fly   334 RMHSAFVPSYADIQQEIRARELYGFFSSYAFLPMVTMK-------KEDSY-DISIE--------A 382
            ::.::|     .:...:.|..|...|.     |.|.||       |.::| .|.||        .
 Worm   352 QLKTSF-----KLYFPVGALTLISLFG-----PAVDMKLQGMESGKAENYRRIVIEKVDCLLDDV 406

  Fly   383 LSDQDFAKK 391
            |:..||.||
 Worm   407 LNFHDFNKK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 50/195 (26%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.